bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3445_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000011889 68.9 4e-11 > 69293.ENSGACP00000011889 Length=99 Score = 68.9 bits (167), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%) Query 39 RLMPLFGRCVVQKVQPATVSKGGIYIPASASPKSGCHMAKVVAVSPPKGTGNSAVSEDWA 98 + +PLF R +V+++ TV+KGGI +P ++ K A VVAV P G+ N Sbjct 5 KFLPLFDRVLVERLVAETVTKGGIMLPEKSAGK--VLQATVVAVGP--GSVNPKGHVLPV 60 Query 99 KLQVGQTVMVPEFGGMKVEVDDEELFVFRGEDILA 133 ++VG+ V++PE+GG KV +DD++ F+FR DIL Sbjct 61 SVKVGEKVLLPEYGGTKVSLDDKDYFLFRDADILG 95 Lambda K H 0.317 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40