bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3456_orf1 Length=265 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1860 78.2 2e-13 > 5807.cgd7_1860 Length=203 Score = 78.2 bits (191), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 55/208 (26%), Positives = 99/208 (47%), Gaps = 20/208 (9%) Query 60 ILFFADSAAAIMFDLPPQAREC--FFVKCSDQESEITGSYQSFFGDGSIRVSVEGPVPSH 117 I F + A+ F L P EC F K +D I GS++ +RVS+ S Sbjct 14 IALFPFNTDALYFILNPGYTECIHFHAKKADH---IVGSFEIDSAYEGVRVSLFENKESS 70 Query 118 RAAAAAAAQLPPLTPLFSSVEETAQLHAKLPLRGEYAVCVRSLLSFEQTVTIDFHLQTQE 177 + + +E + P EY +C ++L++ Q T++F ++ Sbjct 71 K--------------ILDKIENSGDFSINAPKDTEYQLCFKNLMNSVQQ-TVNFSIKNMA 115 Query 178 KNSHPNQLALEDEALKLKGLMNEVLQKANSLFEQQSHAMVRLGVHAELGESTRRRATLWK 237 NS+ N + E+ KL M ++ ++ E+Q +A+ R E ES+R++A +W Sbjct 116 YNSNINNVMSNIESKKLIESMEKLYERITVASEKQRYALTRKRFQMEAIESSRKKAAIWS 175 Query 238 SIQMGMQLVLTALQIYFVKSYFEVKTIV 265 +++ + L A+Q+Y++KSYF+VK +V Sbjct 176 ILELLLSFGLVAIQVYYIKSYFQVKYLV 203 Lambda K H 0.327 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 83755957455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40