bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3529_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0055 87.4 2e-16 > 5833.PF11_0055 Length=424 Score = 87.4 bits (215), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 48/148 (32%), Positives = 79/148 (53%), Gaps = 10/148 (6%) Query 30 AAAAPLLLLLLLQQAAAARPLIDPMKHDIGVVSEATWSGKVLKFRDNSVFSVLFFDPLSA 89 + +LLL +A L++ +KHD+ +V+ + ++ V KFR+ VF+VLFF + Sbjct 7 SCVISFFILLLFCKAYNTSSLLETIKHDLQIVNNSNFNTVVNKFRNEKVFAVLFFKKSNK 66 Query 90 DSRALIDGVYDHFAKKMKGIVQVLAVDCSQNSKLCK--------DHAPSGLPQIVIFPPF 141 + + +I Y+ A K KGI+ + VDC +N+ LC+ D+ S +I+P Sbjct 67 NIKNVIKN-YNDVASKFKGILTLCVVDCDENASLCENELSLYVPDYKSSNTHHFLIYPIN 125 Query 142 PLPKFTFQGPKDVESLSKAVRPLIPSNV 169 P+PKF F+ + ES K LIPS + Sbjct 126 PMPKFVFKD-EITESNIKKYTYLIPSKI 152 Lambda K H 0.321 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38900011563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40