bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3542_orf2 Length=124 Score E Sequences producing significant alignments: (Bits) Value 5478.CAGL0K00803g 100 9e-21 > 5478.CAGL0K00803g Length=103 Score = 100 bits (250), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 1/100 (1%) Query 24 VKHLKGIEEFDEAIK-NGLAIVDFFATWCGPCKMIRPFLEEKSNTMTHINFYGVDVDENP 82 VK + + EFD AI + L +VDFFATWCGPCKMI P +E+ + + +FY +DVDE P Sbjct 2 VKQITSVSEFDSAIAVDKLVVVDFFATWCGPCKMIAPMIEKFAAEYSTADFYKLDVDELP 61 Query 83 ELCEREKVQAMPTFKLYKDGKVVETIVGVLKPKLEEALNN 122 E+ ++ +V AMPT L+K+GK V +VG +++A+ N Sbjct 62 EVAQKNEVSAMPTLVLFKNGKEVAKVVGANPAAIKQAIAN 101 Lambda K H 0.323 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40