bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3601_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0775 70.1 3e-11 > 5833.PF14_0775 Length=177 Score = 70.1 bits (170), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 13/107 (12%) Query 54 TLVFYVVANDGDDLAAPNCFFLRGPPGAPPTLRDVKRQFPIPGRYHFRIKTDGGELGLCG 113 T+VFY + ND +D + N F++ P G+ TL+D+K +FP+ G YHFR K + Sbjct 5 TVVFYHIINDKEDKNSQNVFYILKPIGSI-TLKDIKHEFPLMGTYHFRFKILHNNIP--- 60 Query 114 EQQLAPLLWADLRDEGQPLAAAAAAGPIFLKAVRLSWTGDTAAPAAT 160 W D+ DE P+ + + I+ K +RLSW + T Sbjct 61 -------AWVDVTDESSPVPSLNSC--IYAKVLRLSWLDNKTGKEIT 98 Lambda K H 0.321 0.135 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38900011563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40