bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3670_orf2 Length=172 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_3330 194 6e-49 > 5807.cgd5_3330 Length=210 Score = 194 bits (494), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 97/162 (59%), Positives = 121/162 (74%), Gaps = 4/162 (2%) Query 13 LFLTHIPPVTRVCLVASTVLMALCTLEIISPFSLYMNWQLVFAHAQVWRLITCFLFFGTF 72 L + +IPPVT+V ST+LM LCTL+IISPF+LY+NW LV Q+WRL TCF FFGTF Sbjct 2 LVVNNIPPVTKVYFAISTLLMVLCTLDIISPFNLYLNWLLVINEYQIWRLATCFFFFGTF 61 Query 73 SLHFFWNVYVLIFYCSTLEE---HRRSATFLWMLICTGGLLLAFSYIFGVSSYFFSGSMI 129 SLHFFWN YVL++YC++LE+ H R A FLWMLI +LL SY FG + Y FSG++I Sbjct 62 SLHFFWNAYVLLYYCASLEDVVFHSRPADFLWMLITCSWMLLLLSYFFG-AGYLFSGAVI 120 Query 130 NVMTYIWGRRNPNTRLSIFFMPVLAPYLPFLLALVSLLGGWN 171 NVMTYIWGRRNP+ R+S+F V APYLP++L + L+ GW Sbjct 121 NVMTYIWGRRNPSARMSVFIFTVRAPYLPWVLMGMGLVIGWR 162 Lambda K H 0.335 0.144 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40