bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3773_orf1 Length=200 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000017538 120 4e-26 > 8090.ENSORLP00000017538 Length=1392 Score = 120 bits (300), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 9/202 (4%) Query 3 ILLVRGKLPAKSAIYRKTPDQHTFHKQEIAKLSDNGWIGLTYSSICSRTIMVEKRDDGSG 62 I L G P K IY + + ++ + + G I + S + V K+D G Sbjct 961 IHLCHGTQPPKGHIYPVSLPEREAMEEYLQESLQAGIIRPSSSPAGAGFFFVGKQDGG-- 1018 Query 63 ERKMRMVANYRALNSLT----FPLPPIQTILEMLGGAKYFSTFDLGAGFHQISMAAEDRW 118 +R +YR LN++T +PLP +Q+ +++ G++ F+ DL + +H + + ED W Sbjct 1019 ---LRPCIDYRGLNNITVRNTYPLPLLQSAFDLVKGSQIFTKLDLRSAYHLVRIREEDEW 1075 Query 119 KMAFLSVLGPFEYRVMPFGLKGALATFQANINAYLQHLLGQGVIAYLDDVLIYSPDLCGH 178 K F + G FEY VMPFGL A A FQ IN L+ ++ + V YLDD+L++SPDL H Sbjct 1076 KTTFNTPSGHFEYLVMPFGLTNAPAVFQCLINDVLKDMINRFVFVYLDDILVFSPDLNTH 1135 Query 179 VSLLRQVLSIFLRYQFYPKFRK 200 V +R VL L Q Y K K Sbjct 1136 VQHVRAVLQRLLENQLYCKAEK 1157 Lambda K H 0.326 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47774528022 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40