bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3782_orf1 Length=198 Score E Sequences producing significant alignments: (Bits) Value 7227.CG13185-PA 115 8e-25 > 7227.CG13185-PA Length=5303 Score = 115 bits (288), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 67/128 (52%), Positives = 82/128 (64%), Gaps = 7/128 (5%) Query 49 LGSSSGRHAVLLEGPPGAGKTFVVGLLARLCGRRLVRINLSEDTELADLLGAVVPSAEVE 108 L + S + VLLEGPPG GKT +V + G ++VRINL E T+LADL G +P+ + Sbjct 1751 LSALSLQKPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAED-- 1808 Query 109 ESCGSEGSAEAATQRQKKPPFVWTDGVLTRNLRAGN-WILLDELNLAPQQTLEGLNPLLD 167 S AAT+RQ + FVW DG L L+A N WILLDELNLAPQ LEGLN +LD Sbjct 1809 ---NLLESNTAATERQIR-SFVWRDGPLLAALKAKNTWILLDELNLAPQSVLEGLNAVLD 1864 Query 168 HRRCVYLP 175 HR VY+P Sbjct 1865 HRGEVYIP 1872 Lambda K H 0.314 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46549540124 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40