bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3783_orf2 Length=209 Score E Sequences producing significant alignments: (Bits) Value 4932.YLR106C 96.3 6e-19 > 4932.YLR106C Length=4910 Score = 96.3 bits (238), Expect = 6e-19, Method: Composition-based stats. Identities = 50/93 (53%), Positives = 62/93 (66%), Gaps = 5/93 (5%) Query 117 SQEEMSQFEWVDSALVAAVRKGQWLLLRDAHLCSASVLDRLNALLEDGGSLLLT----EG 172 ++E +FEW D LV AV KG WL+L +A+LCS SVLDRLN+LLE GSLL+ E Sbjct 2185 TKEASVKFEWFDGMLVKAVEKGHWLILDNANLCSPSVLDRLNSLLEIDGSLLINECSQED 2244 Query 173 GAPREVKRHPNFRILLTAEAANTHLLSAALRNR 205 G PR +K HPNFR+ LT + LS A+RNR Sbjct 2245 GQPRVLKPHPNFRLFLTMDPKYGE-LSRAMRNR 2276 Lambda K H 0.317 0.124 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53286973563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40