bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3861_orf2 Length=144 Score E Sequences producing significant alignments: (Bits) Value 9913.ENSBTAP00000004967 132 3e-30 > 9913.ENSBTAP00000004967 Length=419 Score = 132 bits (332), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 65/123 (52%), Positives = 78/123 (63%), Gaps = 0/123 (0%) Query 1 PENPKKYRGLARLPLRGALNPRGGGGSPKARIVFMPPPQMERLDPALKPPGGVDKKEYGG 60 ENP KY+GL RL G LN G S +ARIVFM ++RLDPAL PG VD KEY G Sbjct 295 AENPIKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHIDRLDPALIRPGRVDMKEYVG 354 Query 61 PPPRGKVPQIFQGFFPGQATSLVENFENRVLQTPPQIIPPQGRGSFLRKKKTPPGALQKT 120 R ++ Q+FQ F+PGQATSL ENF +RVLQ QI P Q +G F+ K P GA+Q Sbjct 355 HCSRWQLTQMFQRFYPGQATSLAENFADRVLQATTQISPAQVQGYFMLYKNDPAGAIQNA 414 Query 121 KFL 123 + L Sbjct 415 ESL 417 Lambda K H 0.317 0.145 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40