bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3982_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2450 94.0 2e-18 > 5807.cgd1_2450 Length=915 Score = 94.0 bits (232), Expect = 2e-18, Method: Composition-based stats. Identities = 44/121 (36%), Positives = 75/121 (61%), Gaps = 2/121 (1%) Query 58 NKNDAVEEETLHSWFPATCPGFEARCGDVKRLVKEDLEDPHRRKHLESFRKCMQEWETYD 117 N N A+ E ++S PA F G++K+L +EDL + HRR+HLES+ K EW Y+ Sbjct 17 NTNSALTFEEVNSSIPAFRDDFPVNAGEIKQLRREDLLNEHRRRHLESYYKSSAEWSNYE 76 Query 118 PGAKN--EMQDETASALLADLLKMKPKTSGEFDAAMQSLRKKYKVAPAKSQLVTAYNRFI 175 KN E++ ++ S+ + DL+ + PKT E++ + LR+++KVAP+K+Q++ Y + Sbjct 77 KRQKNDEELEVKSLSSFIHDLILLSPKTKEEYEHVINILRRRHKVAPSKAQIIRVYEELV 136 Query 176 A 176 + Sbjct 137 S 137 Lambda K H 0.315 0.127 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40