bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4073_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.234 88.2 6e-17 > 5833.MAL13P1.234 Length=5987 Score = 88.2 bits (217), Expect = 6e-17, Method: Composition-based stats. Identities = 39/85 (45%), Positives = 60/85 (70%), Gaps = 4/85 (4%) Query 18 RRAVSLEELQVWGCEPLVRSYEPPPLPTILSLESLVISRFRVYCWCSFVLDKMHMMSDLL 77 ++ + EE+Q W P+ +Y+ P +P ++++ + I +F + WCSF+LDKMHMMSDLL Sbjct 5565 KKNLLYEEIQKWTILPVYVNYKSPEIPLAINIQYMQIDKFTLIVWCSFLLDKMHMMSDLL 5624 Query 78 KLGLRILMASGRLELTVRTIGAALT 102 ++GLRILM SG+LEL +GA +T Sbjct 5625 RIGLRILMVSGKLEL----LGAPVT 5645 Lambda K H 0.326 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40