bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4174_orf3 Length=148 Score E Sequences producing significant alignments: (Bits) Value 9685.ENSFCAP00000012514 95.9 3e-19 > 9685.ENSFCAP00000012514 Length=715 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 52/145 (35%), Positives = 63/145 (43%), Gaps = 0/145 (0%) Query 3 EWGGPGLFFLKKGGGGPPFPGGWGGGVFSPFFQGGVFFPPFFLRGTIGFFAGVLGGNPGG 62 +W G G+ + G PFPG VF V +P F IG +L NP Sbjct 570 DWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPER 629 Query 63 GLGPPGGGFGGGKKPPFFRALGGGSLVGRAPPPLFFPPGGGPPCFPHFWGGFPGGAPPGG 122 LG KK PFFR LG +L+ R PP F P G +F F G AP Sbjct 630 RLGSSERDAEDVKKQPFFRTLGWDTLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLS 689 Query 123 PPRGGGPLPPPKKGAFRGFNFGGGG 147 PPR PL ++ AFR F+F GG Sbjct 690 PPRDARPLTATEQAAFRDFDFVAGG 714 Lambda K H 0.323 0.163 0.605 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40