bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4334_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1180w 124 9e-28 > 5833.PFI1180w Length=1292 Score = 124 bits (311), Expect = 9e-28, Method: Composition-based stats. Identities = 53/102 (51%), Positives = 80/102 (78%), Gaps = 0/102 (0%) Query 7 GQWRGGFILSGLEVFLKEHLRFLLRLIALLNVSPTLRGINARSLALQPYTGDITVCPRKL 66 G WR GF++S +E+ KE++R++LRL+ALL++SPT+RG+NA S+A+Q Y GDIT+ P++L Sbjct 1181 GNWRAGFLMSSMEILFKENMRYILRLMALLDLSPTIRGLNAGSIAMQNYNGDITLHPKRL 1240 Query 67 HWKHLKLMNDQSLEDVTCDVQEGRLMAFPKLHLLSNRMQIEK 108 + KH KL++ + +DV +Q+GR M F KL L+ NRM+IEK Sbjct 1241 YLKHFKLISVSNYDDVEWYIQQGRQMTFQKLPLILNRMKIEK 1282 Lambda K H 0.325 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40