bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4372_orf2 Length=129 Score E Sequences producing significant alignments: (Bits) Value 7227.CG2746-PB 127 1e-28 > 7227.CG2746-PB Length=203 Score = 127 bits (318), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 61/94 (64%), Positives = 75/94 (79%), Gaps = 0/94 (0%) Query 11 SRHMGIGKRKGTRDARLPAKVLWMRRQRVLRRLLKKYRDAKKIVSHMYHKLYVRCKGNQF 70 RH G GKRKGT +AR+P K+LWM+RQRVLRRLLKKYRD+KKI H+YH LY++CKGN F Sbjct 73 GRHCGFGKRKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVF 132 Query 71 KNKRVLIEAIHNEKNLKVKEKALQEQVDARKQKA 104 KNKRVL+E IH +K K + K L +Q +AR+QK Sbjct 133 KNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKV 166 Lambda K H 0.318 0.129 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40