bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4425_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G23820.2 78.2 6e-14 > 3702.AT2G23820.2 Length=257 Score = 78.2 bits (191), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 1/84 (1%) Query 3 EKREKEKNAFLFICKFLDD-KRAKEVRELWEEYERGETPEAMLVKDADKFDMITKAFEYE 61 EK +E A +CK L +RAKE+ ELW EYE +PEA +VKD DK ++I +A EYE Sbjct 160 EKNRRESEALEHMCKLLGGGERAKEIAELWREYEENSSPEAKVVKDFDKVELILQALEYE 219 Query 62 NSHGVCLEEFFSSTENAFRTEVFK 85 G LEEFF ST F+T + K Sbjct 220 QDQGKDLEEFFQSTAGKFQTNIGK 243 Lambda K H 0.319 0.131 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40