bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4428_orf2 Length=216 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0218275 147 2e-34 > 44689.DDBDRAFT_0218275 Length=717 Score = 147 bits (371), Expect = 2e-34, Method: Composition-based stats. Identities = 60/154 (38%), Positives = 103/154 (66%), Gaps = 0/154 (0%) Query 24 LQNVLEVFVMLRPDLGYVQGMAFVAATLLLYMDEYSAFVCFANLMLRPSLHAFYTFDMAT 83 L NVLE +V RPD+GYVQGM+++AA LL +DE+++FVC +N + P FYT ++ Sbjct 533 LANVLEAYVCYRPDVGYVQGMSYLAAVFLLILDEFNSFVCLSNFLNNPCYMTFYTMNLDQ 592 Query 84 VQGYFRTFDLLLREKHPLLLQHFQQIGLQTDVFLVDWMYTLFTRCLPFELLGRVWDLFII 143 + Y T D L+ + P + +H +++G+Q D+F++DW+ T+F++ LP ++ VWD + Sbjct 593 MAVYMNTMDQLMAQNLPKIQKHLKELGIQPDIFMIDWVLTVFSKALPLDVASHVWDTIFL 652 Query 144 KGDVLLFQASLAIVSYFHEELQKGSLDECMAILS 177 G+V++FQ +L I+ + ++L+ G D CM +L+ Sbjct 653 DGEVVIFQTALGILKMYSKDLEFGDFDVCMTLLT 686 Lambda K H 0.330 0.143 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 56730992589 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40