bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4471_orf1 Length=105 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0730w 83.6 2e-15 > 5833.PFB0730w Length=1997 Score = 83.6 bits (205), Expect = 2e-15, Method: Composition-based stats. Identities = 34/72 (47%), Positives = 51/72 (70%), Gaps = 0/72 (0%) Query 28 SRDRYYTLSHAVREEVRQPESLVGGTLMPYQMAGLQWMLSLYNNNLHGILGAFLRLAPSL 87 +R+ YY +SH V+E+V+QP L+GG LM YQ+ GL+W++SLYNNNLHGIL + L ++ Sbjct 858 ARENYYNISHVVKEKVKQPSILIGGELMKYQLEGLEWLVSLYNNNLHGILADEMGLGKTI 917 Query 88 MSVECISSSIEF 99 ++ + EF Sbjct 918 QTISLFAYLKEF 929 Lambda K H 0.317 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40