bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4532_orf1 Length=201 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1020c 105 8e-22 > 5833.PFF1020c Length=1356 Score = 105 bits (262), Expect = 8e-22, Method: Composition-based stats. Identities = 47/94 (50%), Positives = 68/94 (72%), Gaps = 1/94 (1%) Query 46 SPAS-SIKSLISLLRYSAHDADVFLNFSNEFTSQCVHPYLNPRTEHDLIGDLEEAFANWY 104 +PA+ +IK LISLLRYS +D+DVF N N F + +P +N RTE D++ D+ E + N+Y Sbjct 574 NPANVNIKELISLLRYSNYDSDVFFNIRNSFINLVTYPNINGRTEKDILLDIHECYKNYY 633 Query 105 KLKKGEDVADVCGHICMRLGRCDKALKFLQVSLQ 138 LK ED+ADVCGHICM+ G +K++ +L+ SL+ Sbjct 634 SLKNDEDIADVCGHICMKFGEFEKSIFYLKESLR 667 Lambda K H 0.325 0.134 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 48387021971 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40