bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4608_orf3 Length=203 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000038713 91.7 1e-17 > 9031.ENSGALP00000038713 Length=287 Score = 91.7 bits (226), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 1/124 (0%) Query 74 LHESLHAPSQTQHRTKGKTLLNVYGEQHPQIPQLLAGESQMLLVTTNGPFGPDFCLHKFD 133 LHE LHA QTQH+ +G L+V Q + QLLA + Q LL+ N F D LH F+ Sbjct 63 LHEDLHASPQTQHQMQGGLFLDVVVRQGAPVFQLLASKDQPLLIGRNAFFVLDLGLHIFN 122 Query 134 LAYNLQIERDRLTLR-CPSNLHAPSQGQHQGKGGLFLNVGIKKGPSILQLFAGKNKTLLI 192 L +E D L + +LH SQ QHQ +GGL L+V +++G I QL K++ LLI Sbjct 123 CVTGLNLEGDGLASQGFHEDLHPTSQAQHQMQGGLLLDVVVRQGAPIFQLLTSKDQPLLI 182 Query 193 RRNA 196 RRNA Sbjct 183 RRNA 186 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 49612009869 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40