bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4651_orf1 Length=236 Score E Sequences producing significant alignments: (Bits) Value 6239.C56C10.7b.2 65.9 1e-09 > 6239.C56C10.7b.2 Length=417 Score = 65.9 bits (159), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 2/156 (1%) Query 78 FRPKDCFTVLFALFPTNPQLFLEDLAKHVPNLGQLTLQWRTSTGGVGTVSDYLLTNVPQP 137 +PKD LF L P + L K + ++G+L + WRTS G G + L + Sbjct 251 LKPKDIRQFLFCLTPADVHNTLG--YKDLTSIGKLDMSWRTSMGEKGRLQTSALQRIAPG 308 Query 138 MQPLEVRLASFPSSVEVDRPFHVELEVINRLNTALQLVLNVKLSELEPFVLEGPSQLTLG 197 + + + P+ V+V +PF V + N AL L L ++ V PS ++LG Sbjct 309 YGDVRLSVEKTPACVDVQKPFEVSCRLYNCSERALDLQLRLEQPSNRHLVFCSPSGVSLG 368 Query 198 PLGPRSSKRFAFELLCLEPGFHSLGGIQVCDSATQQ 233 L P F+ + + G S+ GI++ D+ T++ Sbjct 369 QLPPSQHVDFSLNVFPVTVGIQSISGIRITDTFTKR 404 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 68043068464 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40