bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4652_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000009101 74.3 2e-12 > 7719.ENSCINP00000009101 Length=389 Score = 74.3 bits (181), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 50/147 (34%), Positives = 79/147 (53%), Gaps = 8/147 (5%) Query 30 MAADDREYLSLKVMRLSQPSWETNVWPLVSLRDAAREDADALQAATEEAVNEKWLSSAHA 89 M A L+L+VMRL++PS T+V P+++ + D +L N + Sbjct 1 MDASKEHPLALRVMRLTKPSIITSV-PVLN----DKSDVLSLNLGYSSK-NLTSYGTGET 54 Query 90 LLLPVTQGRVFSGEVFSAYLNITNTSAVQANNVKLQVELFLGHFRYVLFDNSEDPVLSLN 149 L+LP + G +F GE F +YL++ N S NV L +L G R L +++ P SL Sbjct 55 LILPHSFGNIFLGETFVSYLSVNNESGTDVLNVSLMADLQTGSQRITL--SNKTPKESLK 112 Query 150 PEDSFDCTIQHQLEESGTCMLVCSISH 176 P +S D I H+++E GT +LVC++S+ Sbjct 113 PGNSLDEVINHEVKELGTHILVCTVSY 139 Lambda K H 0.316 0.129 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38900011563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40