bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4723_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 208964.PA4588 68.6 6e-11 > 208964.PA4588 Length=445 Score = 68.6 bits (166), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Query 1 AREKLLAMGAKVLTLSDSEGMIYCSQGFSKEDIQRIKEAKAADSCVRVRSFADGDSIVFQ 60 A K++ MG KV++LSDSEG +Y G S E + + E K R+R A+ S+ F Sbjct 245 AARKVMEMGGKVISLSDSEGTLYAEAGLSDEQWEYLMELKNVRRG-RIREMAEQFSLQFL 303 Query 61 NSETPWAVAADLAFPCAKENEVD 83 PW +A D+A PCA +NE+D Sbjct 304 EGRRPWGLACDIALPCATQNELD 326 Lambda K H 0.316 0.128 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40