bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4736_orf2 Length=104 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3790 94.4 8e-19 > 5807.cgd8_3790 Length=318 Score = 94.4 bits (233), Expect = 8e-19, Method: Composition-based stats. Identities = 44/94 (46%), Positives = 60/94 (63%), Gaps = 0/94 (0%) Query 4 SAPIGILKQVCDTLTRNYRGRLYGMLILNAGFLFRSIWQLVSVVLPERTKSKIKLTSSCS 63 +API +LK + L RNYRG L M +NA +F +WQ +S+VLP+ T+ KI L +S Sbjct 223 NAPISLLKDIATNLQRNYRGYLAQMSFINAPIIFWGLWQAISLVLPQSTRDKITLCTSDY 282 Query 64 DEEFLASINRNQIEERYGGTCSNVEDFSWPVMPP 97 E L IN NQ+E++Y GT S+V F PV+PP Sbjct 283 KSELLKWINPNQLEKKYHGTASDVNSFREPVLPP 316 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22759408663 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40