bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4770_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC365.04c 74.3 1e-12 > 4896.SPBC365.04c Length=233 Score = 74.3 bits (181), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 49/131 (37%), Positives = 72/131 (54%), Gaps = 15/131 (11%) Query 51 QDQLQRKKLHQTEKESEHS-SDANDKTSKVP----------LVLFVGNLPLSVSAQEVKE 99 +D+L K+L Q+ + +HS S+ KT K ++LFVGNLP S + ++ Sbjct 51 RDELPEKQLAQSNDKDKHSVSNPPHKTLKSKRQKGKNNDRKVILFVGNLPKDSSVETLQL 110 Query 100 FFGRKLQLFIKDVRLLTEKDTGASKGCGFVEFTNK--EALQIALNYDGRTLSDRKIRVEL 157 F R Q + VR+ T+K +G KG FVEF N + + AL + +RKI +EL Sbjct 111 HFKRAGQ--VPSVRIPTDKTSGRQKGYAFVEFINPKTDVISKALKFHHTIYKERKINIEL 168 Query 158 TAGGGGKSKNR 168 TAGGGGK++ R Sbjct 169 TAGGGGKTEAR 179 Lambda K H 0.313 0.128 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40