bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4933_orf2 Length=179 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G41770.1 213 2e-54 > 3702.AT5G41770.1 Length=705 Score = 213 bits (542), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 100/176 (56%), Positives = 136/176 (77%), Gaps = 0/176 (0%) Query 1 YIYIWISYALFEELQAKDMDRCRSVYEKALEVVPHKLFSFAKLWTLFVAFEIRQLNLERA 60 YIY+WI+YALFEE++ +D++R R VY + L+++PH FSFAK+W L FEIRQLNL A Sbjct 383 YIYLWINYALFEEIETEDIERTRDVYRECLKLIPHSKFSFAKIWLLAAQFEIRQLNLTGA 442 Query 61 RKIFGAAIGKCGKEKIFQAYAQLELRLGNIDRCRQIHAKFIETYPLNPKAWIQMIELEVL 120 R+I G AIGK K+KIF+ Y ++EL+LGN+DRCR+++ +++E P N AW + ELE Sbjct 443 RQILGNAIGKAPKDKIFKKYIEIELQLGNMDRCRKLYERYLEWSPENCYAWSKYAELERS 502 Query 121 AEETERARAICEIAVSMEQMEMPELIWKAYIDMEVNWGALDRARALYERLLDKTQH 176 ETERARAI E+A+S ++MPEL+WKAYID E++ G L+R RALYERLLD+T+H Sbjct 503 LVETERARAIFELAISQPALDMPELLWKAYIDFEISEGELERTRALYERLLDRTKH 558 Lambda K H 0.326 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 36430169559 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40