bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4942_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_3740 72.0 5e-12 > 5807.cgd7_3740 Length=227 Score = 72.0 bits (175), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 36/101 (35%), Positives = 53/101 (52%), Gaps = 0/101 (0%) Query 9 RPDRIAGEPLVQRVLEGSAASFKVDAVFPFYPPLYQWPADYKVLGLKEPMPFSKSFHISK 68 R I+G +++ L+ S A FKV + FYP ++Q Y +GL PMP K +H+ + Sbjct 115 RERFISGRRMIEHCLKESGAKFKVKNYYCFYPKIWQSQDLYSSIGLDAPMPLFKKYHLLQ 174 Query 69 VLEHFGVSKEQVLLIDDDPNNCSAFAAEGGVSLRVAGDRGF 109 V + Q+L IDDD NC +G + L V G+ GF Sbjct 175 VASADKLLPNQILFIDDDIRNCKQALQDGFIVLHVEGNAGF 215 Lambda K H 0.321 0.138 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40