bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4966_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP008136-PA 154 8e-37 > 7165.AGAP008136-PA Length=676 Score = 154 bits (389), Expect = 8e-37, Method: Compositional matrix adjust. Identities = 71/96 (73%), Positives = 84/96 (87%), Gaps = 0/96 (0%) Query 4 LEILGDIPDADMAPPENVLFVAKLNPATQDDDLRLLFSRFGEIVSCDIIRDSRTGQSLQY 63 LEI+GDIPDAD+APPENVLFV KLNP T DDDL+++FSRFG+IV C++IRD TG SLQY Sbjct 224 LEIVGDIPDADIAPPENVLFVCKLNPVTTDDDLQIIFSRFGKIVGCEVIRDKLTGDSLQY 283 Query 64 AFIGFKRREDCESAFFKMQNVLVDDRRIHVDFSQSV 99 AFI F+ ++ CE A+FKM NVL+DDRRIHVDFSQSV Sbjct 284 AFIEFENQKSCEDAYFKMDNVLIDDRRIHVDFSQSV 319 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40