bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4970_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G05530.1 210 8e-54 > 3702.AT3G05530.1 Length=424 Score = 210 bits (535), Expect = 8e-54, Method: Compositional matrix adjust. Identities = 98/132 (74%), Positives = 121/132 (91%), Gaps = 2/132 (1%) Query 1 EKIRLNKQLPYLVGSVVELF--DNEEEGEDDGAATDIDLQRKGKCIVIKTSTRQTVFLPV 58 EKI+LNKQLPYLVG++VE+ + E++ E+DGA D+D QRKGKC+V+KTSTRQT+FLPV Sbjct 62 EKIKLNKQLPYLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPV 121 Query 59 IGLVEADQLKPGDLVGVNKDSYLVLDKLPAEYDARVKAMEVDERPTEEYSDVGGLDKQIQ 118 +GLV+ D LKPGDLVGVNKDSYL+LD LP+EYD+RVKAMEVDE+PTE+Y+D+GGL+KQIQ Sbjct 122 VGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQ 181 Query 119 ELIEAIVLPMTH 130 EL+EAIVLPMTH Sbjct 182 ELVEAIVLPMTH 193 Lambda K H 0.314 0.137 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40