bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4985_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_800 101 7e-21 > 5807.cgd1_800 Length=657 Score = 101 bits (251), Expect = 7e-21, Method: Composition-based stats. Identities = 45/86 (52%), Positives = 65/86 (75%), Gaps = 2/86 (2%) Query 7 NVLVEFYAPWCGFCRKMEPAYKELAKRVAVVSG-LVIARIDATRNEVEGVVIAGYPTLYL 65 +VL+ FYAPWCG CRK+EP Y LA+R+ +S L IA+ID ++NEVE + I GYP++ L Sbjct 540 DVLIVFYAPWCGHCRKLEPDYNVLAQRLRGISDKLKIAKIDGSQNEVENIQILGYPSILL 599 Query 66 YRKGDK-EPVLYSGDRSTRDMLKWLS 90 ++ K EP+LY+GDRS +M++W+S Sbjct 600 FKSEMKTEPILYNGDRSVANMIEWIS 625 Lambda K H 0.323 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40