bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5120_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00038896001 84.0 1e-15 > 99883.GSTENP00038896001 Length=238 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 51/145 (35%), Positives = 78/145 (53%), Gaps = 34/145 (23%) Query 2 ALVRRLRIEEFGVGLAGGNDTATDDAREESVVDAVMRKQRERLTRALNRLAGDLYSSEGH 61 +++ +R EFG+G+ + ES +M+ Q+ERL R+L+RL+ +LYS + H Sbjct 61 SIIEDIRKHEFGIGV---------ELNAES--QKLMQTQQERLGRSLDRLSTELYSKDTH 109 Query 62 LQLELLQNADDNTYILPLQVPPRVLLLEPRRQQRLLLRMPALNIPSLHFELLSEGLGVFN 121 LEL+QNADDNTY P +L P+L F + ++ + + N Sbjct 110 FVLELIQNADDNTY------PSEAGVL-----------------PALAFVVENDCITILN 146 Query 122 NERGFRPVDVRALCDVARSTKAPQQ 146 NE GF+ +VRA+CDV RSTK + Sbjct 147 NEMGFQEKNVRAICDVGRSTKGKHK 171 Lambda K H 0.320 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40