bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5122_orf1 Length=79 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1470c 76.3 2e-13 > 5833.PFF1470c Length=2907 Score = 76.3 bits (186), Expect = 2e-13, Method: Composition-based stats. Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 0/76 (0%) Query 4 SSSSSSSSRGVRKLRFEFPTWLLNFAVYRRFRNEMFLSFCPERKSFLKEIKNEILFELDG 63 S + V+K+ FEFPT +LNF +++++ N+ +L + + KNEI FELDG Sbjct 1006 SEEELKNDNNVKKVDFEFPTNILNFEMHKKWTNDQYLVYNEHTDDYECISKNEIFFELDG 1065 Query 64 PWKGMFLPASEKSDSL 79 PW GMFLPASEKSD L Sbjct 1066 PWHGMFLPASEKSDDL 1081 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22947404809 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40