bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5204_orf1 Length=82 Score E Sequences producing significant alignments: (Bits) Value 391896.A1I_01755 78.2 7e-14 > 391896.A1I_01755 Length=631 Score = 78.2 bits (191), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 36/61 (59%), Positives = 53/61 (86%), Gaps = 0/61 (0%) Query 21 AVDKSTGKRQQITIQSSGGLSEAQIKQMVEDAERFKDEDQRQKDLVAAKNEAETLVYSVE 80 A DK++GK Q++TIQ+SGGLS+A+I+QMV+DAE+ DED++ K+L+ AKN A++L+YS E Sbjct 482 AKDKASGKEQRVTIQASGGLSDAEIEQMVKDAEKNADEDKKHKELIEAKNAADSLIYSTE 541 Query 81 K 81 K Sbjct 542 K 542 Lambda K H 0.305 0.124 0.321 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22731359797 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40