bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5261_orf2 Length=148 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL007322-PA 72.8 3e-12 > 7159.AAEL007322-PA Length=361 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 44/118 (37%), Positives = 61/118 (51%), Gaps = 13/118 (11%) Query 11 LMTLSFVAPSLIIILVELLIAVVRVTEDKEARMKSN---VPMFGWTVPQYIVDMYKYLGG 67 L + P L+I+ EL+ A V+ KSN + ++ T+P +IV+ YK +G Sbjct 127 LYIIGIAVPILVILGTELVRAHVK---------KSNALPLKVYSVTIPYWIVEAYKSIGM 177 Query 68 FGFTMATAWLFADSLKCFVGSLRPHFFDACKPDWSK-VTCKGENGEYIYVEDFHCTND 124 FGF A + L D K +G LRPHFFD C P TCK Y+EDF CT++ Sbjct 178 FGFGAACSQLLTDVGKYTIGRLRPHFFDVCNPRLPDGTTCKDPQNHGRYIEDFICTSE 235 Lambda K H 0.328 0.141 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40