bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5408_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value 5207.CNC01130 120 9e-27 > 5207.CNC01130 Length=489 Score = 120 bits (302), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 63/125 (50%), Positives = 81/125 (64%), Gaps = 11/125 (8%) Query 8 LVLAGLEEGLVVATDLRC---PQMPLAQIDWHKKPITCVEWHPSEEGVFAAASLDDSLTF 64 L+++G +EG + DLR P+AQ WH PIT VEWHP++ VFAA+ DD LT Sbjct 363 LLVSGGDEGGLKVWDLRMFKDTPSPVAQFQWHTAPITSVEWHPTDSSVFAASGSDDQLTL 422 Query 65 WDLSVEREE------PAEVQTAAAAVPEQLMFVHGGQQQISEFHFHPQIPGFVAATASDG 118 WDLSVE +E PA+ AVP QL+FVH GQ+ + E H+HPQIPG V +TASD Sbjct 423 WDLSVEPDEDEAPIGPADGNI--TAVPPQLLFVHQGQKDVKELHWHPQIPGMVISTASDS 480 Query 119 FSIFK 123 F++FK Sbjct 481 FNVFK 485 Lambda K H 0.320 0.134 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40