bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5454_orf3 Length=122 Score E Sequences producing significant alignments: (Bits) Value 383372.Rcas_0695 61.6 7e-09 > 383372.Rcas_0695 Length=968 Score = 61.6 bits (148), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%) Query 12 YNRDPLGALEFEQDIWRLRERLAAGEKVFENMVKELLLENPHRVTLRMKSSAEYAEQQAA 71 Y DPL L FE + +++RL+AGE+VFE+M++E LL NPHR T+ + E +Q A Sbjct 408 YGDDPLAPLMFEAPLRAIKQRLSAGERVFEHMIEEKLLRNPHRTTVVLVPDLELTNRQNA 467 Query 72 VER 74 ER Sbjct 468 AER 470 Lambda K H 0.319 0.132 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40