bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5468_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0268 68.2 6e-11 > 5833.PF11_0268 Length=596 Score = 68.2 bits (165), Expect = 6e-11, Method: Composition-based stats. Identities = 38/134 (28%), Positives = 65/134 (48%), Gaps = 4/134 (2%) Query 2 SEASLLLFGGIDESQVAVSESWMFDLASRQWKEMAFKNKPEARHSHASVYHQQKGTLLVF 61 ++ ++++FGGI+E V E++ FD +++W+ + K P AR+ HAS L + Sbjct 245 NKKNIIIFGGINEKDEIVDETYKFDFQAKKWELIGNKICPRARYKHASFSFND--FLYIH 302 Query 62 GGQGAEGNVLQDAHILEGSSWRPLESATDTLAPCGRCGHSASLCELSNKFVVAVFGGDIS 121 GG ++L D +SW P++ P R HS N +V +FGG+ Sbjct 303 GGLDVNNSLLADMWCFSKNSWTPIKQIDRIPEP--RYAHSLIFSFYGNAKLVFLFGGNKK 360 Query 122 GTGKGENDLWLYDI 135 G D W+++I Sbjct 361 GYNAALGDTWIFNI 374 Lambda K H 0.316 0.132 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40