bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5508_orf2 Length=97 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000013706 73.2 2e-12 > 51511.ENSCSAVP00000013706 Length=1150 Score = 73.2 bits (178), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 35/73 (47%), Positives = 48/73 (65%), Gaps = 3/73 (4%) Query 18 AAHSSTSLHASCANTEGSYVCTCNPGYEPASSDGHACKDVDECAAGTAECHVSAQCVNVD 77 + ++S S+ + C+N GSY C CN GY + +GH CKD+DEC GTA+CH +A C N D Sbjct 573 STNNSCSMKSKCSNLVGSYKCICNSGY---TGNGHTCKDIDECMNGTAKCHHNATCSNTD 629 Query 78 GSFECTCMAGFEA 90 GS+ CTC G+ Sbjct 630 GSYTCTCKPGYSG 642 Lambda K H 0.318 0.127 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22472223870 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40