bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5827_orf2 Length=109 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_4200 102 2e-21 > 5807.cgd6_4200 Length=504 Score = 102 bits (255), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 56/123 (45%), Positives = 78/123 (63%), Gaps = 15/123 (12%) Query 1 LYGILNPSLEEGEEDEEIDNVELPPEVVKIMRANIVLAEEGTAP--------------RS 46 LY I+ P E E++ +LP +V ++M A + E+G P + Sbjct 363 LYSIIQPVATSSSEPMELEEEDLPDDVRRLMDA-FCINEDGKLPEEVASLGSSIIRSAQP 421 Query 47 AGTPISRERAEALRRKVQSVGRLMRVFKTIREENELIMQLKGCTPGDRIPVGLLIQGREG 106 A + IS+ERA+ LR+KVQSV R+MRVF T+RE+NELI++LKG TPG RIP+GLL+ GR+ Sbjct 422 ASSVISKERADTLRKKVQSVARIMRVFSTLREQNELIVKLKGVTPGHRIPMGLLLGGRDA 481 Query 107 LEN 109 LEN Sbjct 482 LEN 484 Lambda K H 0.314 0.137 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22374500883 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40