bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5945_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_1270 113 2e-24 > 5807.cgd8_1270 Length=2007 Score = 113 bits (282), Expect = 2e-24, Method: Composition-based stats. Identities = 47/93 (50%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Query 1 YATYDSTKLMDHCRQHKGRMNIPRLIRTCEKCCLWEEAVYLHTIYDEYEQAANCMILHPM 60 YA Y KLMD+C + GR+NIP+L R CE+ LW E VYL+ Y E++QA +I HP Sbjct 1558 YAKYTPEKLMDYCSSYSGRINIPKLTRICEQRQLWNEVVYLYLQYQEFDQAVLTVISHPK 1617 Query 61 -AWQHDQFIQVIQKVSNVELLYHAISFYLEEHP 92 AW++DQF+ ++Q V+NV++LY +++FYL+EHP Sbjct 1618 EAWKNDQFLSILQNVTNVDILYKSMTFYLQEHP 1650 Lambda K H 0.327 0.137 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40