bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5987_orf1 Length=132 Score E Sequences producing significant alignments: (Bits) Value 266835.mll7073 67.8 9e-11 > 266835.mll7073 Length=550 Score = 67.8 bits (164), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 45/116 (38%), Positives = 59/116 (50%), Gaps = 11/116 (9%) Query 4 NWERFFPSPASGHASATPGTADPAITPADGSSDPSRLQFSYRIDTTITDPLSNLPPSVAG 63 +W RF S P T DPA + RLQF+YRIDT++ L +LP +VAG Sbjct 335 DWGRFIDIDERAGGS-DPDTGDPA--------NERRLQFAYRIDTSLVGFLHDLPKAVAG 385 Query 64 TGPINLAERNLRRGSVFQLPTGQQVAAALNQPQLAAGSIRVRAKLREEPVPGTTDT 119 P +L ERNL RG + LP+GQ VA A+ L I + + +P PG D Sbjct 386 DPPASLGERNLLRGWLLGLPSGQSVARAMGIEPLTDADIIIGKAV--DPPPGAGDV 439 Lambda K H 0.313 0.129 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40