bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_5998_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 281309.BT9727_2111 68.9 4e-11 > 281309.BT9727_2111 Length=132 Score = 68.9 bits (167), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 3/101 (2%) Query 1 DVTQLTFKVKISKIENVRFAHIHIAPVGVNGGIVLNLRTTRVDGPVNGDYAE--GTVTAA 58 D L FK+ + IE+V AH+HI G NG +V L + PV+ + A G +T Sbjct 30 DELSLKFKLDLFDIEDVVAAHLHIGAKGTNGPVVAFLFGP-ITNPVSIECATLTGMITQE 88 Query 59 DLIGNLRGGPLSILKSAIESGNAYTNVHSDKYPAGEIRGQI 99 DL+G L G L L + I SGN Y NVH+ ++P GEIRGQ+ Sbjct 89 DLVGPLAGQTLGTLINEIISGNIYINVHTVQHPNGEIRGQL 129 Lambda K H 0.316 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40