bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6007_orf2 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5833.PF07_0085 107 9e-23 > 5833.PF07_0085 Length=642 Score = 107 bits (267), Expect = 9e-23, Method: Composition-based stats. Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 4/115 (3%) Query 1 HYGAPLAKGVATADHVTCPWHDAKFDLKTGKCIAGPVTQGIQTYPVQVKGSSLFASLPER 60 HY APL GV T +++TCPWHDAKFD+KTG+CI GP I Y V ++G+ ++A LP++ Sbjct 145 HYSAPLKSGVLTNEYITCPWHDAKFDIKTGECINGPSFDDIPKYEVVIEGNEVYALLPKK 204 Query 61 LEEHEHSISC-CKRRETAFKDKTFVIVGGGPAASAAVEELRAQGFEGRLVLISRE 114 LE E C CK + + K +IVGGG A A+E G+ G+L++ S++ Sbjct 205 LEIFEKKRICECK---GSCEKKNILIVGGGAATLGALETFLKLGYNGKLIICSKD 256 Lambda K H 0.318 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40