bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6025_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000026418 69.3 3e-11 > 9258.ENSOANP00000026418 Length=453 Score = 69.3 bits (168), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 2/105 (1%) Query 7 HFSDHFKLQLQTKNIAHLSRHWGDVSMDGNNLNVSVNGCPAFEVNAQDIAQVTTPSKNDL 66 HF F + QT +A HWG + L ++ +++A+ I Q T PSK DL Sbjct 87 HFEKFFNVHPQTLQVASTGWHWGQYEFENQTLRFKIDNSMGIDIDARSITQATVPSKTDL 146 Query 67 AIELVQDDTMDQSEDMLLEIRLFQPATGD-DETDSHLQNLKEKLV 110 AIE Q + S D L+EIR P D DET+ L++LK+ L+ Sbjct 147 AIEFKQKEVTAGS-DELVEIRFCMPTKPDSDETEVQLEDLKQTLL 190 Lambda K H 0.315 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40