bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6086_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P2.24 89.4 3e-17 > 5833.MAL3P2.24 Length=653 Score = 89.4 bits (220), Expect = 3e-17, Method: Composition-based stats. Identities = 38/104 (36%), Positives = 66/104 (63%), Gaps = 0/104 (0%) Query 3 HLVRHYGFMARDVVELAKKESLMEPLVEGLPYLKAEVLYACRYEQARSVSDILARRLPIL 62 HLV +YG+++ +V ELAK+ ++ + PY++AE++YA RYE A ++SDI+ RR + Sbjct 545 HLVSNYGYLSENVCELAKELNMFNKIDPTKPYIEAEIIYATRYEFANTISDIIGRRFRLG 604 Query 63 FLDHKLGVEAIDTVCSMMAKELGWSAATANKKKQEAKKYAETFT 106 F+D ++ + ID + ++ EL W+ NK +EAK Y + + Sbjct 605 FIDSQVSNKVIDKIAQLLKNELTWNTEQVNKNVKEAKDYINSLS 648 Lambda K H 0.318 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40