bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6116_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0282 165 5e-40 > 5833.PF14_0282 Length=2657 Score = 165 bits (417), Expect = 5e-40, Method: Composition-based stats. Identities = 74/146 (50%), Positives = 105/146 (71%), Gaps = 0/146 (0%) Query 1 RMVIGVCAMRVKTDSRPMREILERLENFEEFAVLVFDEKVILEAPIEEWPRVDGLVAFFS 60 + +GVCAM K +S PM IL+RL +F ++ F E +IL I+ WP VD L+AF+S Sbjct 36 KFTLGVCAMESKVESAPMECILKRLAKSGDFHIIKFKEDMILNHDIDCWPIVDCLIAFYS 95 Query 61 SGFPLNKAIAYAQKYKPILLNDLSRQQIIRNRISIYKVLRQHGIPHPSYVVVDYNAVRRG 120 +GFPL KAI Y +KYKPI LN+L +Q I+R+R+ IY+ L++ +PH +YVVVD++ V+RG Sbjct 96 TGFPLKKAIEYVKKYKPITLNNLEKQMILRSRLQIYEELKKWRVPHANYVVVDHDTVKRG 155 Query 121 DAVFSEGYDYLSINGQRINKPFIEKP 146 + +F E YDY+ + R+NKPFIEKP Sbjct 156 EHIFEEYYDYIVYDNIRLNKPFIEKP 181 Lambda K H 0.324 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40