bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6165_orf2 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_3010 108 6e-23 > 5807.cgd1_3010 Length=284 Score = 108 bits (269), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 0/101 (0%) Query 30 MERVRDAARLVKNREKLMQWLSAHQTSVQAWAGLFVCGFLVYHLFSDGDFSFLLTVSSLV 89 ME V A ++ + EK W+S H++SV+A+ L + +V+ SDGDFSFLLT+SSL Sbjct 1 MEVVNSAVTIISDPEKCRTWVSQHKSSVKAYISLAIFCVIVFFFLSDGDFSFLLTLSSLT 60 Query 90 STFSFLMVCFKMEKSKSARGVSLKLFESYLLLTFARLCSIV 130 S FSF MVC K+E +KS GVSL++ E+Y++L FARLCSI+ Sbjct 61 SAFSFAMVCLKIEITKSCAGVSLRMMEAYVILIFARLCSII 101 Lambda K H 0.331 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40