bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6191_orf3 Length=135 Score E Sequences producing significant alignments: (Bits) Value 51511.ENSCSAVP00000001775 77.0 2e-13 > 51511.ENSCSAVP00000001775 Length=150 Score = 77.0 bits (188), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 25/125 (20%), Positives = 61/125 (48%), Gaps = 5/125 (4%) Query 2 EDASVEDPSVEDPSVDEASVDEASVDEASVDEASVDEASVDEAS-----VDEASVDEASV 56 E PSV P E ++DE E ++DE + E + DE +DE + E + Sbjct 22 EQPCYRGPSVRQPCFPETTLDEPCFPETTLDEPCIPETTFDEPCNPKFLIDEPCMPEILI 81 Query 57 DEASVDEASVDEASVDEASVEDASVEDASVDDASVEDASVEDASVEDASVEDASVEDASV 116 DE + E + DE + E ++++ + +A+ D+ + + ++++ + + + ++ + + + Sbjct 82 DEPCIPETTFDEPCIPETTIDEPCIPEATFDEPCIPETTIDEPCIPETTFDEPCIPETTF 141 Query 117 EDASV 121 + + Sbjct 142 GEPCI 146 Lambda K H 0.286 0.107 0.245 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40