bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6409_orf1 Length=97 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4560 61.2 9e-09 > 5807.cgd7_4560 Length=3082 Score = 61.2 bits (147), Expect = 9e-09, Method: Composition-based stats. Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 5/100 (5%) Query 1 MRFGVARRLSRAN-TVEGVRLCGCPGVDNNGDELPCNHMRDFRVPIGRVSVQECLTNAHR 59 ++FGV RR +R+ + LCGCP + G +PC+ +F P+ +V V EC N H Sbjct 439 IQFGVGRRYNRSEINSNTMLLCGCPDFASVG--MPCDDPAEFYFPVAQVRVVECTDNTHC 496 Query 60 ADRQLAYCIKD--HCGGFLVSAAAASVNAFACVRNQDCTL 97 LA C D C G L S A + C+ Q CT+ Sbjct 497 MHNALASCNLDTNQCQGVLPSVAQIGLGTMQCLSRQSCTI 536 Lambda K H 0.328 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22472223870 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40