bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_6526_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P2.7 157 1e-37 > 5833.MAL3P2.7 Length=533 Score = 157 bits (396), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 0/129 (0%) Query 1 EVARVYIGSFWNNPLQNDENRRLFEAEANDLYSDIARVPRDAAIRKLNDFIKRARLAKVH 60 EV RVYIGSFW+ L +DENR +FE EA+DLY +I+++PR++ + +LNDFIKR R KVH Sbjct 252 EVNRVYIGSFWDKKLMHDENRTIFEEEASDLYKEISKIPRNSTMVRLNDFIKRCRTLKVH 311 Query 61 ALLLTTLRNKLPMFGKESKKKQLINQLGTIYQQVSQEYGVPIGDFPPLATMQEKLASFEW 120 LLT LR KLP F K K++++N L IY++VS++Y +P+GDFPP+ M+EKL +W Sbjct 312 IYLLTHLRKKLPFFKKFLNKRKIVNSLEKIYEEVSKDYNLPLGDFPPVQFMKEKLLDMDW 371 Query 121 SKIPRLDMK 129 +IP+L+ K Sbjct 372 MRIPKLETK 380 Lambda K H 0.320 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40